PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015425
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Dof
Protein Properties Length: 277aa    MW: 29897.8 Da    PI: 8.7816
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015425genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.75.4e-382279461
       zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                  +l+cprCds+ntkfCyynnyslsqPr+fCk+C+ryWt+GG+lrnvPvGgg+rkn+k+
  Lus10015425 22 PQLRCPRCDSSNTKFCYYNNYSLSQPRHFCKSCKRYWTRGGTLRNVPVGGGCRKNHKR 79
                 6789***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-261178IPR003851Zinc finger, Dof-type
PfamPF027011.1E-322378IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1522478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MENPISSSSA AAGGQDNNNQ PPQLRCPRCD SSNTKFCYYN NYSLSQPRHF CKSCKRYWTR  60
GGTLRNVPVG GGCRKNHKRP NNSTSAANKR LPLPLPSSSS SATSTLVLES PNHHNNQINN  120
PLLYGLQHYP APEASSHHPH HLVSSFSSNG LGYSGISPSM ATLLASTLNN KFSSSSTSSN  180
GIVKPDHYSA GFEGLQMGIH GGVKAHYQEQ GQDWNINNFG NNQNNLGWGQ VLMNDHHHHH  240
NQVVEGVGSG QEPGYWTGLW SDPGSNNIGP SVTSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0839422e-34AC083942.8 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0002D01, from chromosome 3, complete sequence.
GenBankAC1376982e-34AC137698.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0014A21, from chromosome 3, complete sequence.
GenBankAP0149592e-34AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126112e-34CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ84TE96e-36DOF53_ARATH; Dof zinc finger protein DOF5.3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-34TARGET OF MONOPTEROS 6